PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT32403
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 108aa    MW: 12247.1 Da    PI: 10.1675
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT32403genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181561248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+WT+eEd++l+ +++q+G g+W++ ++  g+ R++k+c++rw +yl
         EMT32403 15 GKWTEEEDDILASYIAQHGEGSWRSLPKNAGLLRCGKSCRLRWVNYL 61
                     89*****************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-22563IPR009057Homeodomain-like
PROSITE profilePS5129419.6965IPR017930Myb domain
SMARTSM007174.6E-121363IPR001005SANT/Myb domain
SuperFamilySSF466896.36E-221589IPR009057Homeodomain-like
PfamPF002497.6E-171561IPR001005SANT/Myb domain
CDDcd001671.60E-101661No hitNo description
PROSITE profilePS500904.56562100IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.7E-86488IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MGRAPCCQKL GLKQGKWTEE EDDILASYIA QHGEGSWRSL PKNAGLLRCG KSCRLRWVNY  60
LRDGVKRGSF SKEEDDLIVK LHATIGKSTT NIGNNKKYIW IRKPPSKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558096.15e-52PREDICTED: myb-related protein P-like
SwissprotP278982e-46MYBP_MAIZE; Myb-related protein P
TrEMBLM8CDZ21e-75M8CDZ2_AEGTA; Myb-related protein P
STRINGBRADI1G64687.12e-51(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62610.13e-43myb domain protein 11